Proteintech, 67025-1-Ig, DDX5 Monoclonal antibody

Size: 20ul / 150ul The DDX5 (67025-1-Ig) by Proteintech is a Monoclonal antibody targeting DDX5 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 67025-1-Ig targets DDX5 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NCI-H1299 cells, A431 cells, HSC-T6 cells, HeLa cells, HEK-293 cell, HepG2 cells, HT-29 cells, NIH/3T3 cells, 4T1 cells Positive IP detected in: HeLa cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information DDX5 or p68, a member of DEAD/H BOX, which has a characteristic DEAD box, is a proliferation-associated nuclear antigen. DDX5 involves in the alternative regulation of pre-mRNA splicing, act as a RNA helicase to increase tau exon10 inclusion in a RBM4-dependent manner. It's also a transcription coactivator for extrogen receptor ESR1 and androgen receptor AR. Once synergized with DDX17 and SRA1 RNA, DDX5 activated MYOD1 transcription activity and involved in skeletal muscle differentiation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, bovine Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24821 Product name: Recombinant human DDX5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 434-614 aa of NM_004396 Sequence: RSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 Observed Molecular Weight: 69 kDa GenBank Accession Number: NM_004396 Gene Symbol: DDX5 Gene ID (NCBI): 1655 RRID: AB_2882340 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P17844 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.