Proteintech, 67026-1-Ig, GLUD1 Monoclonal antibody

Size: 20ul / 150ul The GLUD1 (67026-1-Ig) by Proteintech is a Monoclonal antibody targeting GLUD1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 67026-1-Ig targets GLUD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, L02 cells, HuH-7 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Human glutamate dehydrogenase (GDH), an enzyme central to the metabolism of glutamate, is known to exist in housekeeping and nerve tissue-specific isoforms encoded by the GLUD1 and GLUD2 genes, respectively. It catalyses the reversible inter-conversion of glutamate to alpha-ketoglutarate and ammonia, thus interconnecting amino acid and carbohydrate metabolism. GLUD1 might contribute to the formation of specific synapses in the hippocampus such as those formed by the projecting neurons of the entorhinal cortex(PMID: 22138648). GLUD1 has a calculated molecular mass of 61 kDa and an apparent molecular mass of 45-55 kDa with the 53aa transit peptide removed. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6179 Product name: Recombinant human GLUD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 214-558 aa of BC040132 Sequence: FIGPGIDVPAPDMSTGEREMSWIADTYASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFGDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGKHGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYVNAIEKVFKVYNEAGVTFT Predict reactive species Full Name: glutamate dehydrogenase 1 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC040132 Gene Symbol: GLUD1 Gene ID (NCBI): 2746 RRID: AB_2882341 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P00367 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.