Proteintech, 67125-1-Ig, EHF Monoclonal antibody

Size: 20ul / 150ul The EHF (67125-1-Ig) by Proteintech is a Monoclonal antibody targeting EHF in WB, ELISA applications with reactivity to human samples 67125-1-Ig targets EHF in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, human brain tissue, A431 cells, NCCIT cell, T-47D cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information ETS homologous factor (EHF) is also named Epithelium-specific Ets transcription factor 3 (ESE-3), ESE3B and ESEJ. EHF is a member of the E26 transformation-specific (ETS) gene superfamily (PMID: 12894586). EHF as a tumour suppressor in PDAC. In PDAC, EHF promotes E-cadherin expression and suppresses epithelial-mesenchymal transition (PMID: 27923832). EHF deficiency induces the conversion and expansion of Treg cells and MDSCs by inhibiting TGFβ1 and GM-CSF secretion (PMID: 30733283). In prostate cancer, EHF plays a vital role in the inhibition of cell-intrinsic CSCs signal by suppressing STAT3 and repressing the expression of TWIST1, ZEB2, BMI1 and POU5F1 (PMID: 27732936, PMID: 22505649). EHF not only plays a cell autonomous role in regulating CSC stemness but also has important functions in regulating the sensitivity to a pro-CSC stimulus from the PSC niche (PMID: 33674341). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28769 Product name: Recombinant human EHF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-199 aa of BC038995 Sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHT Predict reactive species Full Name: ets homologous factor Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC038995 Gene Symbol: EHF Gene ID (NCBI): 26298 RRID: AB_2882425 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NZC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.