Proteintech, 67136-1-Ig, TRIM21 Monoclonal antibody

Size: 20ul / 150ul The TRIM21 (67136-1-Ig) by Proteintech is a Monoclonal antibody targeting TRIM21 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67136-1-Ig targets TRIM21 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HL-60 cells, HSC-T6 cells, Jurkat cells, NIH/3T3 cells, NCI-H1299 cells, HepG2 cells, PC-12 cells Positive IHC detected in: human breast cancer tissue, human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information TRIM21 has multiple N-terminal zinc finger motifs(has E3 ligase activity), a central leucine zipper, and a potential N-glycosylation site. TRIM21 is a E3 ubiquitin-protein ligase. It can form a ubiquitin ligase complex with E2 UBE2D2, which function not only for the uniquitination of USP4 and IKBKB but also for its self-ubiquitination. It has a role in the regulation of the cell cycle progression and could enhance the decapping activity of DCP2. It can exist in all mammalian cells as a ribonucleoprotein particle , which composed of a single polypeptide and 1 of 4 small RNA molecules. TRIM21 exists various isoforms and range molecular weight of isoforms is about 42-45kDa and 49-54 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28377 Product name: Recombinant human TRIM21 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 176-475 aa of BC010861 Sequence: SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY Predict reactive species Full Name: tripartite motif-containing 21 Calculated Molecular Weight: 475 aa, 54 kDa Observed Molecular Weight: 42-54 kDa GenBank Accession Number: BC010861 Gene Symbol: TRIM21 Gene ID (NCBI): 6737 RRID: AB_2882435 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P19474 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.