Proteintech, 67151-1-Ig, HDAC3 Monoclonal antibody

Size: 20ul / 150ul The HDAC3 (67151-1-Ig) by Proteintech is a Monoclonal antibody targeting HDAC3 in WB, ELISA applications with reactivity to Human, mouse, rat samples 67151-1-Ig targets HDAC3 in WB, IP, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, HEK-293 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. Histone deacetylase (HDAC) and histone acetyltransferase (HAT) are enzymes that regulate transcription by selectively deacetylating or acetylating the (-amino groups of lysines located near the amino termini of core histone proteins. At least 4 classes of HDAC were identified. HDAC3 is a class I HDAC. HDAC3 has histone deacetylase activity and may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. HDAC3 can also down-regulate p53 function and thus modulate cell growth and apoptosis. The gene encoding HDAC3 is regarded as a potential tumor suppressor gene. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28464 Product name: Recombinant human HDAC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 187-395 aa of BC000614 Sequence: VMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTVRNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADA Predict reactive species Full Name: histone deacetylase 3 Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC000614 Gene Symbol: HDAC3 Gene ID (NCBI): 8841 RRID: AB_2923631 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15379 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.