Proteintech, 67171-1-Ig, TRIB2 Monoclonal antibody

Size: 20ul / 150ul The TRIB2 (67171-1-Ig) by Proteintech is a Monoclonal antibody targeting TRIB2 in WB, ELISA applications with reactivity to human, mouse samples 67171-1-Ig targets TRIB2 in WB, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, U-937 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7501 Product name: Recombinant human TRIB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-343 aa of BC002637 Sequence: MNIHRSTPITIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLREEEAARLFYQIASAVAHCHDGGLVLRDLKLRKFIFKDEERTRVKLESLEDAYILRGDDDSLSDKHGCPAYVSPEILNTSGSYSGKAADVWSLGVMLYTMLVGRYPFHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN Predict reactive species Full Name: tribbles homolog 2 (Drosophila) Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC002637 Gene Symbol: TRIB2 Gene ID (NCBI): 28951 RRID: AB_2882467 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q92519 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.