Iright
BRAND / VENDOR: Proteintech

Proteintech, 67212-1-Ig, CDC42 Monoclonal antibody

CATALOG NUMBER: 67212-1-Ig
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDC42 (67212-1-Ig) by Proteintech is a Monoclonal antibody targeting CDC42 in WB, ELISA applications with reactivity to human, mouse, rat samples 67212-1-Ig targets CDC42 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, rat brain tissue, mouse cerebellum tissue, HEK-293 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Background Information Cdc42, the human homologue of the cell division cycle 42 of Saccharomyces cerevisiae, belongs to the Rho/Rac subfamily of Ras-like GTPases. It acts as molecular switches to regulate numerous cellular responses including the organization of the actin cytoskeleton, gene transcription, cell cycle progression, and membrane trafficking Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28550 Product name: Recombinant human CDC42 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-186 aa of BC002711 Sequence: MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSR Predict reactive species Full Name: cell division cycle 42 (GTP binding protein, 25kDa) Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC002711 Gene Symbol: CDC42 Gene ID (NCBI): 998 RRID: AB_2918484 Conjugate: Unconjugated Form: Liquid Purification Method: Caprylic acid/ammonium sulfate precipitation UNIPROT ID: P60953 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924