Proteintech, 67221-1-Ig, SLC31A1 Monoclonal antibody

Size: 20ul / 150ul The SLC31A1 (67221-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC31A1 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 67221-1-Ig targets SLC31A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28410 Product name: Recombinant human SLC31A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species Full Name: solute carrier family 31 (copper transporters), member 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC013611 Gene Symbol: SLC31A1 Gene ID (NCBI): 1317 RRID: AB_2882512 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15431 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.