Proteintech, 67230-1-Ig, MRP4 Monoclonal antibody

Size: 20ul / 150ul The MRP4 (67230-1-Ig) by Proteintech is a Monoclonal antibody targeting MRP4 in WB, IHC, ELISA applications with reactivity to human samples 67230-1-Ig targets MRP4 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information MRP4 (also known as ABCC4), belonging to ATP-binding cassette (ABC) transporter family, is a multi-transmembrane protein that is able to transport a range of organic anionic compounds (both endogenous and xenobiotic) out of the cell. It can exclude various drugs thus is considered as potential target to prevent drug-resistance. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10171 Product name: Recombinant human ABCC4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 347-707 aa of BC041560 Sequence: TASRVFVAVTLYGAVRLTVTLFFPSAIERVSEAIVSIRRIQTFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWDKASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLRSNILFGKKYEKERYEKVIKACALKKDLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDDPLSAVDAEVSRHLFELCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQDTENVPVTLSEENRSEGKVGFQAYKNYFRA Predict reactive species Full Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 4 Calculated Molecular Weight: 859 aa, 97 kDa Observed Molecular Weight: 160-180 kDa GenBank Accession Number: BC041560 Gene Symbol: MRP4 Gene ID (NCBI): 10257 RRID: AB_2882517 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O15439 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.