Proteintech, 67240-1-Ig, NQO1 Monoclonal antibody

Size: 20ul / 150ul The NQO1 (67240-1-Ig) by Proteintech is a Monoclonal antibody targeting NQO1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, rat samples 67240-1-Ig targets NQO1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HSC-T6 cells, L02 cells, K-562 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information NQO1, also named as DIA4, NMOR1, DTD and QR1, belongs to the NAD(P)H dehydrogenase (quinone) family. This enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis. It is known to be involved in benzene metabolism. In human studies of ozone exposure, polymorphisms in oxidative stress genes (NQO1, GSTM1, GSTP1) modify respiratory symptoms, lung function, biomarkers and risk of asthma. (PMID:18511640; 18848868 ) Specification Tested Reactivity: human, rat Cited Reactivity: human, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28933 Product name: Recombinant human NQO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-144 aa of BC007659 Sequence: MVGRRALIVLAHSERTSFNYAMKEAAAAALKKKGWEVVESDLYAMNFNPIISRKDITGKLKDPANFQYPAESVLAYKEGHLSPDIVAEQKKLEAADLVIFQFPLQWFGVPAILKGWFERVFIGEFAYTYAAMYDKGPFRSKKAV Predict reactive species Full Name: NAD(P)H dehydrogenase, quinone 1 Calculated Molecular Weight: 274 aa, 31 kDa Observed Molecular Weight: 29-31 kDa GenBank Accession Number: BC007659 Gene Symbol: NQO1 Gene ID (NCBI): 1728 RRID: AB_2882519 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15559 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.