Proteintech, 67241-1-Ig, Thrombospondin 1 Monoclonal antibody

Size: 20ul / 150ul The Thrombospondin 1 (67241-1-Ig) by Proteintech is a Monoclonal antibody targeting Thrombospondin 1 in WB, ELISA applications with reactivity to Human, rat, mouse samples 67241-1-Ig targets Thrombospondin 1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, rat, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, rat spleen tissue, NIH/3T3 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Thrombospondin 1(TSP-1), an extracellular matrix protein, is the first identified natural angiogenesis inhibitor. A variety of normal cells, including endothelial cells, fibroblasts, adipocytes, smooth muscle cells, monocytes, macrophages, and transformed cells such as malignant glioma cells, secrete Thrombospondin 1. It regulates cellular phenotype during tissue genesis and repair. It acts as a molecular facilitator by bringing together cytokines, growth factors, matrix components, membrane receptors and extracellular proteases. Thrombospondin 1 binds to a wide variety of integrin and non-integrin cell surface receptors. It is also a major activator of transforming growth factor (TGFβ1). Secreted TSP1 is a glycoprotein with a molecular mass of 150-180 kDa. Specification Tested Reactivity: Human, rat, mouse Cited Reactivity: human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29129 Product name: Recombinant human THBS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-250 aa of NM_003246 Sequence: GGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS Predict reactive species Full Name: thrombospondin 1 Calculated Molecular Weight: 129 kDa Observed Molecular Weight: 160 kDa GenBank Accession Number: NM_003246 Gene Symbol: Thrombospondin 1 Gene ID (NCBI): 7057 RRID: AB_2882520 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P07996 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.