Proteintech, 67249-1-Ig, ULBP2 Monoclonal antibody

Size: 20ul / 150ul The ULBP2 (67249-1-Ig) by Proteintech is a Monoclonal antibody targeting ULBP2 in WB, ELISA applications with reactivity to Human samples 67249-1-Ig targets ULBP2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HL-60 cells, TF-1 cells, K-562 cells, THP-1 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NKG2D is an activating cell surface receptor that is predominantly expressed on cytotoxic immune cells. NKG2D recognizes a wide range of ligands. In humans, the NKG2D ligand (NKG2DL) includes MICA, MICB, and six members of the ULBP family (ULBP1-6) (PMID: 29568297; 30813924). ULBPs are MHC class I-related molecules (PMID: 11239445). ULBP2 contains two Ig-like domains, the alpha-1 and alpha-2 domains characteristic of the MHC class I family, but lacks the alpha-3 domain. It can be expressed as either a transmembrane or GPI-linked protein, or released from the cell surface (PMID: 21224393; 24614922). ULBP2 binds and activates the NKG2D, mediating the recruitment and activation of NK cells. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28879 Product name: Recombinant human ULBP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-224 aa of BC034689 Sequence: AGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRA Predict reactive species Full Name: UL16 binding protein 2 Calculated Molecular Weight: 246 aa, 27 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC034689 Gene Symbol: ULBP2 Gene ID (NCBI): 80328 RRID: AB_2882526 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BZM5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.