Proteintech, 67257-1-Ig, SIRT5 Monoclonal antibody

Size: 20ul / 150ul The SIRT5 (67257-1-Ig) by Proteintech is a Monoclonal antibody targeting SIRT5 in WB, IHC, ELISA applications with reactivity to human samples 67257-1-Ig targets SIRT5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, L02 cells, LNCaP cells, K-562 cells Positive IHC detected in: human liver cancer tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information SIRT5, a member fo sirtuin family that is a mitochondrial matrix NAD(+)-dependent deacetylase and mono-ADP-ribosyltransferases. Sirtuins play important role in various cellular processed, such as aging, gene silencing and metabolism. SIRT5 mainly locates in . It is an efficient protein lysine desuccinylase and demalonylase. During prolonged fasting, it can activate CPS1, the committed and regulated enzyme of the urea cycle, and contribute to the regulation of blood ammonia levels. Specification Tested Reactivity: human Cited Reactivity: human, bovine Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7743 Product name: Recombinant human SIRT5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-310 aa of BC000126 Sequence: MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS Predict reactive species Full Name: sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae) Calculated Molecular Weight: 34 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC000126 Gene Symbol: SIRT5 Gene ID (NCBI): 23408 RRID: AB_2882530 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NXA8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.