Iright
BRAND / VENDOR: Proteintech

Proteintech, 67293-1-Ig, luciferase Monoclonal antibody

CATALOG NUMBER: 67293-1-Ig
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The luciferase (67293-1-Ig) by Proteintech is a Monoclonal antibody targeting luciferase in WB, ELISA applications with reactivity to Gaussia princeps samples 67293-1-Ig targets luciferase in WB, ELISA applications and shows reactivity with Gaussia princeps samples. Tested Applications Positive WB detected in: Recombinant protein Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information This antibody is designed to detect the luciferase of luciferase (Gaussia princeps) tagged protein. Specification Tested Reactivity: Gaussia princeps Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13000 Product name: Recombinant dNGLUC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-185 aa of AY015993 Sequence: MGVKVLFALICIAVAEAKPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEMEANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPGFKDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKIKGAGGD Predict reactive species Full Name: luciferase Calculated Molecular Weight: 20 kDa GenBank Accession Number: AY015993 RRID: AB_2882558 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924