Proteintech, 67359-1-Ig, RALBP1 Monoclonal antibody

Size: 20ul / 150ul The RALBP1 (67359-1-Ig) by Proteintech is a Monoclonal antibody targeting RALBP1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 67359-1-Ig targets RALBP1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, Jurkat cells, HEK-293 cells, LNCaP cells, MCF-7 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28618 Product name: Recombinant human RALBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC013126 Sequence: MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQ Predict reactive species Full Name: ralA binding protein 1 Calculated Molecular Weight: 655 aa, 76 kDa Observed Molecular Weight: 95 kDa GenBank Accession Number: BC013126 Gene Symbol: RALBP1 Gene ID (NCBI): 10928 RRID: AB_2882611 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q15311 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.