Proteintech, 67364-1-Ig, HDAC9 Monoclonal antibody

Size: 20ul / 150ul The HDAC9 (67364-1-Ig) by Proteintech is a Monoclonal antibody targeting HDAC9 in WB, ELISA applications with reactivity to human samples 67364-1-Ig targets HDAC9 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Daudi cells, HepG2 cells, Raji cells, K-562 cells, Ramos cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information HDAC9, also named as Histone deacetylase 7B, is a 1011 amino acid protein, which is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. HDAC9 represses MEF2-dependent transcription. HDAC9 is broadly expressed, with highest levels in brain, heart, muscle and testis. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28514 Product name: Recombinant human HDAC9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 335-440 aa of BC152405 Sequence: PAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGTHKL Predict reactive species Full Name: histone deacetylase 9 Calculated Molecular Weight: 1011 aa, 111 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC152405 Gene Symbol: HDAC9 Gene ID (NCBI): 9734 RRID: AB_2882616 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UKV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.