Proteintech, 67411-1-Ig, TYK2 Monoclonal antibody

Size: 20ul / 150ul The TYK2 (67411-1-Ig) by Proteintech is a Monoclonal antibody targeting TYK2 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, rat samples 67411-1-Ig targets TYK2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, K-562 cells, MJ cells, Jurkat cells, MOLT-4 cells, TF-1 cells, HSC-T6 cells, A549 cells, THP-1 cells Positive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: Human, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9442 Product name: Recombinant human TYK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 901-1187 aa of BC014243 Sequence: RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHIIKYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHSQHYIHRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYYASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKCPCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC Predict reactive species Full Name: tyrosine kinase 2 Calculated Molecular Weight: 1187 aa, 134 kDa Observed Molecular Weight: 134 kDa GenBank Accession Number: BC014243 Gene Symbol: TYK2 Gene ID (NCBI): 7297 RRID: AB_2882652 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P29597 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.