Proteintech, 67484-1-Ig, AHCYL2 Monoclonal antibody

Size: 20ul / 150ul The AHCYL2 (67484-1-Ig) by Proteintech is a Monoclonal antibody targeting AHCYL2 in WB, IHC, ELISA applications with reactivity to Human samples 67484-1-Ig targets AHCYL2 in WB, IHC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HeLa cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19614 Product name: Recombinant human AHCYL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-115 aa of BC024325 Sequence: MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEA Predict reactive species Full Name: S-adenosylhomocysteine hydrolase-like 2 Calculated Molecular Weight: 611 aa, 67 kDa Observed Molecular Weight: 67 and 57 kDa GenBank Accession Number: BC024325 Gene Symbol: AHCYL2 Gene ID (NCBI): 23382 RRID: AB_2882711 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96HN2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.