Proteintech, 67497-1-Ig, GNB3 Monoclonal antibody

Size: 20ul / 150ul The GNB3 (67497-1-Ig) by Proteintech is a Monoclonal antibody targeting GNB3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67497-1-Ig targets GNB3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: hTERT-RPE1 cells, HepG2 cells, L02 cells, pig brain tissue, rat retina tissue, Raji cells, Ramos cells, Daudi cells, RKO cells, Karpas-422 cells, IMR-32 cells, Rat brain cells, Mouse brain cells, rat brain tissue, mouse brain tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Guanine nucleotide-binding proteins (g proteins) are involved as a modulator or transducer in various transmembrane signaling systems, by integrating signals between receptors and effector proteins. G proteins are composed of an alpha, a beta, and a gamma subunit. This gene encodes a 34 kd beta subunit, being expressed in all tissues. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7050 Product name: Recombinant human GNB3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 3-340 aa of BC002454 Sequence: EMEQLRQEAEQLKKQIADARKACADVTLAELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQELICFSHESIICSITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN Predict reactive species Full Name: guanine nucleotide binding protein (G protein), beta polypeptide 3 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 35-37 kDa GenBank Accession Number: BC002454 Gene Symbol: GNB3 Gene ID (NCBI): 2784 RRID: AB_2882721 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P16520 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.