Proteintech, 67547-1-Ig, UQCRC2 Monoclonal antibody

Size: 20ul / 150ul The UQCRC2 (67547-1-Ig) by Proteintech is a Monoclonal antibody targeting UQCRC2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 67547-1-Ig targets UQCRC2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, pig brain tissue, human placenta tissue, pig heart tissue, pig kidney, rat brain tissue, mouse brain tissue Positive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6874 Product name: Recombinant human UQCRC2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 103-453 aa of BC000484 Sequence: IEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL Predict reactive species Full Name: ubiquinol-cytochrome c reductase core protein II Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC000484 Gene Symbol: UQCRC2 Gene ID (NCBI): 7385 RRID: AB_2882763 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P22695 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.