Proteintech, 67577-1-Ig, ANGPTL4 Monoclonal antibody

Size: 20ul / 150ul The ANGPTL4 (67577-1-Ig) by Proteintech is a Monoclonal antibody targeting ANGPTL4 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 67577-1-Ig targets ANGPTL4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue, COLO 320 cells, Caco-2 cells, HT-29 cells, mouse brain tissue, A549 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Angiopoietin-like protein 4 (ANGPTL4), a member of the angiopoietin-like protein subfamily, is a secretory protein that functions as an important modulator of glucose and lipid metabolism. ANGPTL4 inhibits lipoprotein lipase (LPL)-dependent lipolysis thereby limiting the uptake of free fatty acids. Overexpression of ANGPTL4 results in hypertriglyceridemia, while ANGPTL4 deficiency suppresses foam formation in macrophages and protects against atherosclerosis. ANGPTL4 may play a role in several cancers and it also has been shown to prevent the metastatic process by inhibiting vascular activity as well as tumor cell motility and invasiveness. Decreased expression of this protein has been associated with type 2 diabetes. ANGPTL4 has three isoforms, 45 kDa, 41 kDa and 27 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30070 Product name: Recombinant human ANGPTL4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-374 aa of BC023647 Sequence: MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKL Predict reactive species Full Name: angiopoietin-like 4 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC023647 Gene Symbol: ANGPTL4 Gene ID (NCBI): 51129 RRID: AB_2882790 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BY76 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.