Proteintech, 67580-1-Ig, Beta Arrestin 1 Monoclonal antibody

Size: 20ul / 150ul The Beta Arrestin 1 (67580-1-Ig) by Proteintech is a Monoclonal antibody targeting Beta Arrestin 1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 67580-1-Ig targets Beta Arrestin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, NIH/3T3 cells, human peripheral blood platelets, K-562 cells, Jurkat cells, HSC-T6 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information β-Arrestins (ARRBs), the best known regulators of G protein-coupled receptor signaling, are versatile and multifunctional adapter proteins that regulate diverse cellular functions, including cell growth, apoptosis and immune responses. Overexpression of beta Arrestin 1 has been found in various cancers, indicating it as a potential therapeutic target for cancer treatment. Recently expression of ARRB1 in saliva has been identified as a candidate circadian biomarker. ARRB1 migrated as a doublet of two bands of 45 and 55 kDa (PMID:28947386). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7504 Product name: Recombinant human Arrestin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 69-418 aa of BC003636 Sequence: DVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNR Predict reactive species Full Name: arrestin, beta 1 Calculated Molecular Weight: 47 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC003636 Gene Symbol: Beta Arrestin 1 Gene ID (NCBI): 408 RRID: AB_2882791 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49407 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.