Proteintech, 67584-1-Ig, PTP4A1 Monoclonal antibody

Size: 20ul / 150ul The PTP4A1 (67584-1-Ig) by Proteintech is a Monoclonal antibody targeting PTP4A1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 67584-1-Ig targets PTP4A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, Jurkat cells, HeLa cells, HepG2 cells, HEK-293 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information PTP4A1(protein tyrosine phosphatase type IVA, member 1), also named as PRL1, HH72, PRL-1, PTP(CAAX1), PTPCAAX1, DKFZp779M0721, belongs to the protein-tyrosine phosphatase family, which play an important role in maintaining appropriate tyrosine phosphorylation levels in the cell during development and tissue regeneration (PMID:19341304). PTP4A1 is a PTPase and that it is highly expressed in growing hepatic cells and some tumor cell lines and is located primarily in the cell nucleus, and its overexpression modulates the growth of cells (PMID:8196618). PTP4A1 can exist as dimer, trimer and higher oligomers in vivo (PMID: 15571731, 18224294). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14436 Product name: Recombinant human PTP4A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-173 aa of BC023975 Sequence: MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ Predict reactive species Full Name: protein tyrosine phosphatase type IVA, member 1 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 18-20 kDa GenBank Accession Number: BC023975 Gene Symbol: PTP4A1 Gene ID (NCBI): 7803 RRID: AB_2923632 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q93096 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.