Iright
BRAND / VENDOR: Proteintech

Proteintech, 67629-1-Ig, PSME3 Monoclonal antibody

CATALOG NUMBER: 67629-1-Ig
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PSME3 (67629-1-Ig) by Proteintech is a Monoclonal antibody targeting PSME3 in WB, IHC, ELISA applications with reactivity to Human, Rat samples 67629-1-Ig targets PSME3 in WB, IHC, ELISA applications and shows reactivity with Human, Rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, K-562 cells, HSC-T6 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information PSME3 gene encodes proteasome activator complex subunit 3, which is also called REG-gamma or PA28-gamma. REG-gamma activates the trypsin-like catalytic subunit of the proteasome thus is a proteasome regulator. MDM2-TP53 interaction which promotes ubiquitination- and MDM2-dependent proteasomal degradation of TP53, may be promoted by REG-gamma resulting in inhibited apoptosis after DNA damage. REG-gamma may also be involved in cell cycle regulation. Specification Tested Reactivity: Human, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6716 Product name: Recombinant human PSME3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-254 aa of BC001423 Sequence: MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY Predict reactive species Full Name: proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC001423 Gene Symbol: PSME3 Gene ID (NCBI): 10197 RRID: AB_2882830 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P61289 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924