Product Description
Size: 20ul / 150ul
The P2RY1 (67654-1-Ig) by Proteintech is a Monoclonal antibody targeting P2RY1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples
67654-1-Ig targets P2RY1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
Tested Applications
Positive WB detected in: pig brain tissue, pig cerebellum tissue, rat brain tissue, rat cerebellum tissue, mouse brain tissue, mouse cerebellum tissue, rabbit brain tissue
Positive IHC detected in: mouse brain tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: rat brain tissue, mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:500-1:2000
Immunofluorescence (IF)-P: IF-P : 1:200-1:800
Specification
Tested Reactivity: human, mouse, rat, pig, rabbit
Cited Reactivity: human, mouse, rat
Host / Isotype: Mouse / IgG1
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag12762 Product name: Recombinant human P2RY1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species
Full Name: purinergic receptor P2Y, G-protein coupled, 1
Calculated Molecular Weight: 373 aa, 42 kDa
Observed Molecular Weight: 55 kDa
GenBank Accession Number: BC074785
Gene Symbol: P2RY1
Gene ID (NCBI): 5028
RRID: AB_2882853
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein G purification
UNIPROT ID: P47900
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924