Iright
BRAND / VENDOR: Proteintech

Proteintech, 67654-1-Ig, P2RY1 Monoclonal antibody

CATALOG NUMBER: 67654-1-Ig
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The P2RY1 (67654-1-Ig) by Proteintech is a Monoclonal antibody targeting P2RY1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 67654-1-Ig targets P2RY1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig brain tissue, pig cerebellum tissue, rat brain tissue, rat cerebellum tissue, mouse brain tissue, mouse cerebellum tissue, rabbit brain tissue Positive IHC detected in: mouse brain tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12762 Product name: Recombinant human P2RY1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species Full Name: purinergic receptor P2Y, G-protein coupled, 1 Calculated Molecular Weight: 373 aa, 42 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC074785 Gene Symbol: P2RY1 Gene ID (NCBI): 5028 RRID: AB_2882853 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P47900 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924