Proteintech, 67675-1-Ig, ERP29 Monoclonal antibody

Size: 20ul / 150ul The ERP29 (67675-1-Ig) by Proteintech is a Monoclonal antibody targeting ERP29 in WB, IHC, IF-P, ELISA applications with reactivity to Human, Mouse, Rat samples 67675-1-Ig targets ERP29 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human liver tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human kidney tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30262 Product name: Recombinant human ERP29 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 40-261 aa of BC101495 Sequence: PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL Predict reactive species Full Name: endoplasmic reticulum protein 29 Calculated Molecular Weight: 261 aa, 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC101495 Gene Symbol: ERP29 Gene ID (NCBI): 10961 RRID: AB_2882870 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30040 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.