Proteintech, 67681-1-Ig, NOX4 Monoclonal antibody

Size: 20ul / 150ul The NOX4 (67681-1-Ig) by Proteintech is a Monoclonal antibody targeting NOX4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 67681-1-Ig targets NOX4 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, U-87 MG cells, HSC-T6 cells, HepG2 cells, HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NOX4 (NADPH oxidase 4) is a phagocyte-type oxidase, similar to that responsible for the production of large amounts of reactive oxygen species (ROS) in neutrophil granulocytes with resultant antimicrobial activity and it has been postulated to function in the kidney as an oxygen sensor that regulates the synthesis of erythropoietin in the renal cortex. Studies have reported molecular masses of Nox4 protein by western blot analysis ranging from 55 to 80 kDa. The truncated NOX4 splice variant D (28 kDa) lacks the majority of the transmembrane domain and has been shown to produce higher levels of ROS and DNA damage compared to its prototype. NOX4D has previously been shown to localise to the nucleus and nucleolus in various cell types and is implicated in the generation of reactive oxygen species (ROS) and DNA damage (PMID: 11728818, PMID: 29285262, PMID: 14670934). Nox4 in cardiac myocytes is primarily expressed in mitochondria, and upregulation of Nox4 induced by hypertrophic stimuli elicits mitochondrial dysfunction and cardiac failure. In breast or ovarian tumor cells, mitochondrial Nox4 contributes to oncogenesis. In vascular endothelial cells, however, Nox4 is expressed in the endoplasmic reticulum (ER) and plays a specific role in redox-mediated ER signaling (PMID: 24259511). Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6176 Product name: Recombinant human NOX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 224-578 aa of BC040105 Sequence: PGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEESLNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS Predict reactive species Full Name: NADPH oxidase 4 Calculated Molecular Weight: 67 kDa Observed Molecular Weight: 58-67 kDa GenBank Accession Number: BC040105 Gene Symbol: NOX4 Gene ID (NCBI): 50507 RRID: AB_2882874 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NPH5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.