Proteintech, 67686-1-Ig, cyclin B1 Monoclonal antibody

Size: 20ul / 150ul The cyclin B1 (67686-1-Ig) by Proteintech is a Monoclonal antibody targeting cyclin B1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 67686-1-Ig targets cyclin B1 in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, NIH/3T3 cells, HSC-T6 cells, K-562 cells, Jurkat cells, HEK-293 cells Positive IHC detected in: human tonsillitis tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HT-29 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Cyclin B1 is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase of the cell cycle. The different transcripts result from the use of alternate transcription initiation sites. The antibody is specific to CCNB1. We got a 55-60 kDa band in western blotting maybe due to phosphorylation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29444 Product name: Recombinant human CCNB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC006510 Sequence: MALRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEE Predict reactive species Full Name: cyclin B1 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC006510 Gene Symbol: Cyclin B1 Gene ID (NCBI): 891 RRID: AB_2882879 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P14635 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.