Proteintech, 67697-1-Ig, FBXO6 Monoclonal antibody

Size: 20ul / 150ul The FBXO6 (67697-1-Ig) by Proteintech is a Monoclonal antibody targeting FBXO6 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67697-1-Ig targets FBXO6 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells, MOLT-4 cells, K-562 cells, U-937 cells, RAW 264.7 cells, HSC-T6 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FBXO6(F-box only protein 6 ) is also named as FBG2, FBS2, FBX6 and belongs to the F-box protein family. FBXO6 is the substrate recognition component of a Skp1-Cullin1-F-box protein (SCF) ubiquitin E3 ligase complex, recognizing the chitobiose in unfolded N-glycoprotein to target glycoproteins for polyubiquitination and degradation. It can regulate Chk1 ubiquitination and degradation in both normally cycling cells and during replication stress. This protein is mainly detected in the cytoplasm in both cultured cells and in tumor tissues. Its expression is a predictive biomarker of tumor responsiveness to the important anticancer drugs. Positive Fbxo6 expression correlated with early TNM stage and favorable prognosis of NSCLC patients. (PMID:19716789, PMID: 27855403, PMID: 31140586). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30512 Product name: Recombinant human FBXO6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-293 aa of BC020880 Sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF Predict reactive species Full Name: F-box protein 6 Calculated Molecular Weight: 293 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC020880 Gene Symbol: FBXO6 Gene ID (NCBI): 26270 RRID: AB_2882889 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NRD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.