Proteintech, 67720-1-Ig, GIMAP2 Monoclonal antibody

Size: 20ul / 150ul The GIMAP2 (67720-1-Ig) by Proteintech is a Monoclonal antibody targeting GIMAP2 in WB, ELISA applications with reactivity to Human samples 67720-1-Ig targets GIMAP2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: MOLT-4 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4368 Product name: Recombinant human GIMAP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-258 aa of BC032345 Sequence: MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAE Predict reactive species Full Name: GTPase, IMAP family member 2 Calculated Molecular Weight: 337 aa, 38 kDa Observed Molecular Weight: 33-38 kDa GenBank Accession Number: BC032345 Gene Symbol: GIMAP2 Gene ID (NCBI): 26157 RRID: AB_2918500 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UG22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.