Proteintech, 67793-1-Ig, Desmin Monoclonal antibody

Size: 20ul / 150ul The Desmin (67793-1-Ig) by Proteintech is a Monoclonal antibody targeting Desmin in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, pig samples 67793-1-Ig targets Desmin in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: pig heart tissue, mouse skeletal muscle tissue, mouse testis tissue, pig skeletal muscle, pig colon Positive IHC detected in: human colon tissue, human placenta tissue, human rectal cancer tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon tissue, human appendicitis tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Desmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin. Specification Tested Reactivity: human, mouse, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9675 Product name: Recombinant human Desmin protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 121-470 aa of BC032116 Sequence: NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL Predict reactive species Full Name: desmin Calculated Molecular Weight: 470 aa, 54 kDa Observed Molecular Weight: 52 kDa GenBank Accession Number: BC032116 Gene Symbol: Desmin Gene ID (NCBI): 1674 RRID: AB_2918557 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P17661 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.