Proteintech, 67819-1-Ig, SLC25A42 Monoclonal antibody

Size: 20ul / 150ul The SLC25A42 (67819-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC25A42 in WB, ELISA applications with reactivity to human samples 67819-1-Ig targets SLC25A42 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, LNCaP cells, Jurkat cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26379 Product name: Recombinant human SLC25A42 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of BC045598 Sequence: MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSAKEAFRVLYYTYLNEGFLSLWRGNSATMVRV Predict reactive species Full Name: solute carrier family 25, member 42 Calculated Molecular Weight: 318 aa, 35 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC045598 Gene Symbol: SLC25A42 Gene ID (NCBI): 284439 RRID: AB_2918582 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86VD7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.