Proteintech, 67840-1-Ig, LIG1 Monoclonal antibody

Size: 20ul / 150ul The LIG1 (67840-1-Ig) by Proteintech is a Monoclonal antibody targeting LIG1 in WB, ELISA applications with reactivity to Human, mouse, rat samples 67840-1-Ig targets LIG1 in WB, CoIP, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, Jurkat cells, MOLT-4 cells, K-562 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information DNA ligase I (LIG1) joins DNA strand breaks during DNA replication and repair transactions and contributes to genome integrity. 67840-1-Ig is raised agains the C-terminal 670-919 aa residues of the human DNA ligase 1. Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12489 Product name: Recombinant human LIG1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 670-919 aa of BC108318 Sequence: LVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY Predict reactive species Full Name: ligase I, DNA, ATP-dependent Calculated Molecular Weight: 919 aa, 102 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC108318 Gene Symbol: LIG1 Gene ID (NCBI): 3978 RRID: AB_2918602 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P18858 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.