Proteintech, 67861-1-Ig, CBS Monoclonal antibody

Size: 20ul / 150ul The CBS (67861-1-Ig) by Proteintech is a Monoclonal antibody targeting CBS in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 67861-1-Ig targets CBS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, Jurkat cells, K-562 cells, NCI-H1299 cells, HeLa cells, THP-1 cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information The CBS gene encodes cystathionine beta-synthase, which catalyzes the first irreversible step of transsulfuration. The CBS enzyme is a homotetramer of 63-kD subunits and requires pyridoxal phosphate and heme for activity(PMID:11230183). CBS protein is localized in most areas of the brain, but predominantly in the cell bodies and neuronal processes of Purkinje cells and Ammon's horn neurons(PMID:12588964). Specification Tested Reactivity: human, rat Cited Reactivity: mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7008 Product name: Recombinant human CBS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 206-551 aa of BC000440 Sequence: VAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK Predict reactive species Full Name: cystathionine-beta-synthase Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 61-63 kDa GenBank Accession Number: BC000440 Gene Symbol: CBS Gene ID (NCBI): 875 RRID: AB_2918619 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P35520 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.