Proteintech, 67916-1-Ig, PGD Monoclonal antibody

Size: 20ul / 150ul The PGD (67916-1-Ig) by Proteintech is a Monoclonal antibody targeting PGD in WB, IF/ICC, ELISA applications with reactivity to Human samples 67916-1-Ig targets PGD in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, Jurkat cells, K-562 cells, Hela cells, HEK-293 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PGD, also named as PGDH, belongs to the 6-phosphogluconate dehydrogenase family. PGD catalyses the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate in the context of the oxidative part of the pentose phosphate pathway. PGD is important for the production of NADPH, which is necessary for reductive biosynthesis, such as the formation of lipids and nucleotides, and the activity of enzymes involved in maintaining cell integrity, in combatting oxidative stress and in the first line of immunological defence. (PMID: 35234135) Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6871 Product name: Recombinant human PGD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 137-483 aa of BC000368 Sequence: YGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA Predict reactive species Full Name: phosphogluconate dehydrogenase Calculated Molecular Weight: 53 kDa Observed Molecular Weight: 53 kDa, 45 kDa GenBank Accession Number: BC000368 Gene Symbol: PGD Gene ID (NCBI): 5226 RRID: AB_2918670 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P52209 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.