Proteintech, 67953-1-Ig, RAB14 Monoclonal antibody

Size: 20ul / 150ul The RAB14 (67953-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB14 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 67953-1-Ig targets RAB14 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: LNCaP cells, pig brain tissue, HCT 116 cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, HEK-293 cells, Jurkat cells, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse ovary tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information RAB14, the final member of the Rab11 subfamily, participates in the regulation of cell secretion, ensuring the timely release of necessary substances outside the cell. RAB14 is ubiquitously expressed and localizes to the Golgi/TGN and at early endosomes (PMID: 16962593, 22595670). RAB14 contains 215 amino acids, with a molecular weight of approximately 24.6 kDa Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8167 Product name: Recombinant human RAB14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-215 aa of BC006081 Sequence: MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCGC Predict reactive species Full Name: RAB14, member RAS oncogene family Calculated Molecular Weight: 215 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC006081 Gene Symbol: RAB14 Gene ID (NCBI): 51552 RRID: AB_2918705 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P61106 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.