Proteintech, 67956-1-Ig, Caspase 7 Monoclonal antibody

Size: 20ul / 150ul The Caspase 7 (67956-1-Ig) by Proteintech is a Monoclonal antibody targeting Caspase 7 in WB, IHC, ELISA applications with reactivity to Human, mouse, rat samples 67956-1-Ig targets Caspase 7 in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, PC-12 cells, RAW 264.7 cells Positive IHC detected in: rat stomach tissue, human liver cancer tissue, mouse liver tissue, mouse stomach tissue, rat liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Caspase 7(CASP7), like caspases 3 and 6, contains a short prodomain and, upon apoptotic induction, the 35 kDa proform is converted into a 32 kDa intermediate or preactive form which is further processed into two active subunits consisting of the p20 or large (18 kDa) subunit and the p10 or small (11 kDa) subunit and it is present in the brain, which is up-regulated and activated after traumatic injury(PMID:15953353). Caspase-7 is classified as a member of the subgroup of cysteine proteases most related to the Caenorhabditis elegans factor CED-3, which also includes caspase-3, -6, and -9(PMID:9426061). The protein is involved in the activation cascade of caspases responsible for apoptosis execution. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27601 Product name: Recombinant human Caspase 7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-100 aa of BC015799 Sequence: MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC Predict reactive species Full Name: caspase 7, apoptosis-related cysteine peptidase Calculated Molecular Weight: 303 aa, 34 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC015799 Gene Symbol: Caspase 7 Gene ID (NCBI): 840 RRID: AB_2918707 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P55210 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.