Proteintech, 67964-1-Ig, PI3 Kinase p110 Delta Monoclonal antibody

Size: 20ul / 150ul The PI3 Kinase p110 Delta (67964-1-Ig) by Proteintech is a Monoclonal antibody targeting PI3 Kinase p110 Delta in WB, IF/ICC, ELISA applications with reactivity to Human samples 67964-1-Ig targets PI3 Kinase p110 Delta in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, Jurkat cells Positive IF/ICC detected in: LNCaP cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: Human Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26995 Product name: Recombinant human PIK3CD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 395-580 aa of BC132919 Sequence: YAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSAL Predict reactive species Full Name: phosphoinositide-3-kinase, catalytic, delta polypeptide Calculated Molecular Weight: 1044 aa, 120 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC132919 Gene Symbol: PIK3CD Gene ID (NCBI): 5293 RRID: AB_2918715 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O00329 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.