Proteintech, 67975-1-Ig, ARHGEF16 Monoclonal antibody

Size: 20ul / 150ul The ARHGEF16 (67975-1-Ig) by Proteintech is a Monoclonal antibody targeting ARHGEF16 in WB, IF/ICC, ELISA applications with reactivity to human samples 67975-1-Ig targets ARHGEF16 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, HepG2 cells, Hela cells, HEK-293 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Small GTPases of the Rho family are critical regulators of various cellular functions including actin cytoskeleton organization, activation of kinase cascades, mitogenesis, transcriptional activation and stimulation of DNA synthesis. Rho proteins cycle between a biologically active GTP-bound state and an inactive GDP-bound state. Rho guanine nucleotide exchange factor (GEF) has a crucial role in activating small GTPase by exchange GDP for GTP. ARGEF16 is one of the multiple GEF members. Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28675 Product name: Recombinant human ARHGEF16 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-421 aa of BC002681 Sequence: MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV Predict reactive species Full Name: Rho guanine exchange factor (GEF) 16 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC002681 Gene Symbol: ARHGEF16 Gene ID (NCBI): 27237 RRID: AB_2918724 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5VV41 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.