Proteintech, 67991-1-Ig, DDX1 Monoclonal antibody

Size: 20ul / 150ul The DDX1 (67991-1-Ig) by Proteintech is a Monoclonal antibody targeting DDX1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 67991-1-Ig targets DDX1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, 4T1 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: mouse brain tissue, mouse lung tissue, mouse skin tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information DDX1 is a DEAD box protein, which is putative RNA helicases with a characteristic asp-glu-ala-asp (DEAD) box motif. DEAD box proteins involve in translation initiation, splicing, and ribosome and spliceosome assembly by altering RNA secondary structure. As a RNA helicase, DDX1 has a role in RNA clearance at DNA double-strand breaks (DSBs), thereby facilitating the template-guided repair of transcriptionally active regions of the genome. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16774 Product name: Recombinant human DDX1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 391-740 aa of BC012132 Sequence: IPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 Calculated Molecular Weight: 740 aa, 82 kDa Observed Molecular Weight: 82 kDa GenBank Accession Number: BC012132 Gene Symbol: DDX1 Gene ID (NCBI): 1653 RRID: AB_2918740 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q92499 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.