Proteintech, 68021-1-Ig, CRMP1 Monoclonal antibody

Size: 20ul / 150ul The CRMP1 (68021-1-Ig) by Proteintech is a Monoclonal antibody targeting CRMP1 in WB, IHC, ELISA applications with reactivity to Mouse, Rat, Rabbit, Pig, Chicken, Human samples 68021-1-Ig targets CRMP1 in WB, IHC, ELISA applications and shows reactivity with Mouse, Rat, Rabbit, Pig, Chicken, Human samples. Tested Applications Positive WB detected in: mouse cerebellum tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue Positive IHC detected in: mouse brain tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Background Information CRMP1 (Collapsin response mediator protein 1) is also named as DPYSL1, ULIP3, DRP-1 and belongs to the collapsin response mediator protein family, which are a family of five cytoplasmic proteins predominantly expressed in the developing nervous system. CRMP1, the predicted 62 kDa protein and its 74 kDa isoform corresponding to its N-terminal splice variant already described for embryonic, neonatal, and adult brain of the rat are evidenced in the cortex of adult mouse (PMID:15834957). This protein is involved in invasion, and aggressiveness of prolactin pituitary tumors. Specification Tested Reactivity: Mouse, Rat, Rabbit, Pig, Chicken, Human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30090 Product name: Recombinant human CRMP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 291-537 aa of BC000252 Sequence: WSKNWAKAAAFVTSPPLSPDPTTPDYLTSLLACGDLQVTGSGHCPYSTAQKAVGKDNFTLIPEGVNGIEERMTVVWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRIAVGSDADVVIWDPDKLKTITAKSHKSAVEYNIFEGMECHGSPLVVISQGKIVFEDGNINVNKGMGRFIPRKAFPEHLYQRVKIRNKVFGLQGVSRGMYDGPVYEVPATPKYATPAPSAKSSPSKHQPPPIRNLHQS Predict reactive species Full Name: collapsin response mediator protein 1 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 62 kDa GenBank Accession Number: BC000252 Gene Symbol: CRMP1 Gene ID (NCBI): 1400 RRID: AB_2918766 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14194 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.