Proteintech, 68030-1-Ig, CISD1 Monoclonal antibody

Size: 20ul / 150ul The CISD1 (68030-1-Ig) by Proteintech is a Monoclonal antibody targeting CISD1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit, chicken samples 68030-1-Ig targets CISD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, pig brain tissue, rabbit brain tissue, rat brian tissue, mouse brain tissue, chicken brain tissue, mouse cerebellum tissue Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: H9C2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MitoNEET, also named CISD1, belongs to a previously uncharacterized ancient family of proteins for which the hallmark is the presence of a unique 39 amino acid CDGSH domain. It is a single-pass type III membrane protein, located in mitochondrion outer membrane and may play a role in regulating maximal capacity for electron transport and oxidative phosphorylation. MitoNEET is a recently identified drug target for a commonly prescribed diabetes drug, Pioglitazone. This antibody recognizing MitoNEET (calculated 12 kDa) as a 17 kDa protein may be due to its posttranslational modification or metal binding activity. Specification Tested Reactivity: human, mouse, rat, pig, rabbit, chicken Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8560 Product name: Recombinant human mitoNEET,CISD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-108 aa of BC007043 Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET Predict reactive species Full Name: CDGSH iron sulfur domain 1 Calculated Molecular Weight: 108 aa, 12 kDa Observed Molecular Weight: 14-17 kDa GenBank Accession Number: BC007043 Gene Symbol: CISD1 Gene ID (NCBI): 55847 RRID: AB_2918772 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NZ45 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.