Proteintech, 68060-1-Ig, GEN1 Monoclonal antibody

Size: 20ul / 150ul The GEN1 (68060-1-Ig) by Proteintech is a Monoclonal antibody targeting GEN1 in WB, ELISA applications with reactivity to human samples 68060-1-Ig targets GEN1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A549 cells, U2OS cells, K-562 cells, Daudi cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information GEN1 is a endonuclease which resolves Holliday junctions (HJs) by the introduction of symmetrically related cuts across the junction point, to produce nicked duplex products in which the nicks can be readily ligated. GEN1 efficiently cleaves both single and double HJs contained within large recombination intermediates. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31247 Product name: Recombinant human GEN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 730-908 aa of NM_182625 Sequence: NESRDSKILKGDQLLQEDYKVNTSVPYSVSNTVVKTCNVRPPNTALDHSRKVDMQTTRKILMKKSVCLDRHSSDEQSAPVFGKAKYTTQRMKHSSQKHNSSHFKESGHNKLSSPKIHIKETEQCVRSYETAENEESCFPDSTKSSLSSLQCHKKENNSGTCLDSPLPLRQRLKLRFQST Predict reactive species Full Name: Gen homolog 1, endonuclease (Drosophila) Calculated Molecular Weight: 103 kDa Observed Molecular Weight: 98-100 kDa GenBank Accession Number: NM_182625 Gene Symbol: GEN1 Gene ID (NCBI): 348654 RRID: AB_2918801 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q17RS7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.