Proteintech, 68126-1-Ig, RBP5 Monoclonal antibody

Size: 20ul / 150ul The RBP5 (68126-1-Ig) by Proteintech is a Monoclonal antibody targeting RBP5 in WB, IF/ICC, ELISA applications with reactivity to Human, pig samples 68126-1-Ig targets RBP5 in WB, IF/ICC, ELISA applications and shows reactivity with Human, pig samples. Tested Applications Positive WB detected in: pig kidney tissue, pig liver tissue, pig liver tisse Positive IF/ICC detected in: HepG2 cells, A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information RBP5 (CRBP III) belongs to the fatty-acid binding protein (FABP) family. Human liver and kidney contain the highest levels of CRBP III mRNA, and CRBP III is as a major human intracellular carrier of retinol (PMID:11274389). RBP5 iron response are reversible by genetic complementation. And increased RBP5 expression occurs by a post-transcriptional feedback mechanism whereby RBP5 interacts with its own, and with PAP2 mRNAs. RBP5 is the most significant of the proteins upregulated by iron starvation (PMID:34161395). RBP5 has an estimated molecular mass (15.9 kDa) typical of this protein superfamily (PMID:11274389). Specification Tested Reactivity: Human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24562 Product name: Recombinant human RBP5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-135 aa of BC029355 Sequence: MPPNLTGYYRFVSQKNMEDYLQALNISLAVRKIALLLKPDKEIEHQGNHMTVRTLSTFRNYTVQFDVGVEFEEDLRSVDGRKCQTIVTWEEEHLVCVQKGEVPNRGWRHWLEGEMLYLELTARDAVCEQVFRKVR Predict reactive species Full Name: retinol binding protein 5, cellular Calculated Molecular Weight: 135 aa, 16 kDa Observed Molecular Weight: 16-18 kDa GenBank Accession Number: BC029355 Gene Symbol: RBP5 Gene ID (NCBI): 83758 RRID: AB_2935257 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P82980 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.