Proteintech, 68228-1-Ig, PGK2 Monoclonal antibody

Size: 20ul / 150ul The PGK2 (68228-1-Ig) by Proteintech is a Monoclonal antibody targeting PGK2 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples 68228-1-Ig targets PGK2 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: A549 cells, human testis tissue, HuH-7 cells, Raji cells, MOLT-4 cells, pig heart tissue, rat heart tissue Positive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse testis tissue Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information PGK2, phosphoglycerate kinase 2, which belongs to the phosphoglycerate kinase superfamily. It catalyzes the first ATP-generating step in the central metabolic pathway of glycolysis, converting 1,3-bisphosphoglycerate and ADP to 3-phosphoglycerate and ATP. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20631 Product name: Recombinant human PGK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 242-360 aa of BC038843 Sequence: YTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV Predict reactive species Full Name: phosphoglycerate kinase 2 Calculated Molecular Weight: 417 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC038843 Gene Symbol: PGK2 Gene ID (NCBI): 5232 RRID: AB_2935316 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P07205 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.