Proteintech, 68232-1-Ig, TTC30A Monoclonal antibody

Size: 20ul / 150ul The TTC30A (68232-1-Ig) by Proteintech is a Monoclonal antibody targeting TTC30A in WB, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 68232-1-Ig targets TTC30A in WB, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: LNCaP cells, rat testis tissue, HeLa cells, HEK-293 cells, mouse testis tissue Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Tetratricopeptide repeat protein 30A (TTC30A) as a component of ciliary segmentation, may be essential for cartilage differentiation and renal tubulogenesis (PMID: 34548398). It is required for polyglutamylation of axonemal tubulin and plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18361 Product name: Recombinant human TTC30A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-342 aa of BC042848 Sequence: MAGLSGAQIPDGEFTALVYRLIRDARYAEAVQLLGRELQRSPRSRAGLSLLGYCYYRLQEFALAAECYEQLGQLHPELEQYRLYQAQALYKACLYPEATRVAFLLLDNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGEGGEESGGDNETDGQVNLGCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLALAYYSSRQYASALKHIAEIIERGIRQHPELGVGMTTEGFDVRSVGNTLVLHQTALVEAFNLKAAIEYQLRNYEVAQETLTDMPPRAEEELDPVTLHNQALMNMDARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADV Predict reactive species Full Name: tetratricopeptide repeat domain 30A Calculated Molecular Weight: 665 aa, 76 kDa Observed Molecular Weight: 72-76 kDa GenBank Accession Number: BC042848 Gene Symbol: TTC30A Gene ID (NCBI): 92104 RRID: AB_2935319 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q86WT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.