Iright
BRAND / VENDOR: Proteintech

Proteintech, 68241-1-Ig, OPA3 Monoclonal antibody

CATALOG NUMBER: 68241-1-Ig
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OPA3 (68241-1-Ig) by Proteintech is a Monoclonal antibody targeting OPA3 in WB, ELISA applications with reactivity to Human samples 68241-1-Ig targets OPA3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, K-562 cells, A431 cells, HEK-293 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The OPA3 cDNA encodes a deduced 179-amino acid protein. Northern blot analysis demonstrated a primary transcript of approximately 5.0 kb that was ubiquitously expressed, most prominently in skeletal muscle and kidney. Mutations in this gene have been shown to result in 3-methylglutaconic aciduria type III and autosomal dominant optic atrophy and cataract. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8173 Product name: Recombinant human OPA3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-179 aa of BC005059 Sequence: ANRIKEAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALEELRTELQEVRAQLCNPGRSASHAVPASKK Predict reactive species Full Name: optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia) Calculated Molecular Weight: 179 aa, 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC005059 Gene Symbol: OPA3 Gene ID (NCBI): 80207 RRID: AB_2935328 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9H6K4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924