Proteintech, 68319-1-Ig, SF4 Monoclonal antibody

Size: 20ul / 150ul The SF4 (68319-1-Ig) by Proteintech is a Monoclonal antibody targeting SF4 in WB, FC (Intra), ELISA applications with reactivity to human samples 68319-1-Ig targets SF4 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, NCCIT cells, A549 cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, MOLT-4 cells, K-562 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8014 Product name: Recombinant human SF4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-348 aa of BC002986 Sequence: LYEPNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPATTCPASSTPAPTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKGLGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQHGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMETFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVDGAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY Predict reactive species Full Name: splicing factor 4 Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 55 kDa, 72 kDa GenBank Accession Number: BC002986 Gene Symbol: SF4 Gene ID (NCBI): 57794 RRID: AB_3085055 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IWZ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.