Proteintech, 68321-1-Ig, MTHFD1L Monoclonal antibody

Size: 20ul / 150ul The MTHFD1L (68321-1-Ig) by Proteintech is a Monoclonal antibody targeting MTHFD1L in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, rabbit samples 68321-1-Ig targets MTHFD1L in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: U2OS cells, HEK-293 cells, rabbit testis tissue, rat testis tissue, LNCaP cells, HeLa cells, HepG2 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information MTHFD1L(Monofunctional C1-tetrahydrofolate synthase, mitochondrial) is also named as FTHFSDC1(Formyltetrahydrofolate synthetase). MTHFD1L enzyme is present in mitochondria from normal embryonic tissues and embryonic fibroblast cell lines, and embryonic mitochondria possess the ability to synthesize formate from glycine. It catalyzes the final step in the mitochondrial conversion of 1-C units to formate in embryos. Moreover, MTHFD1L levels were substantially higher in embryonic mitochondria than in adult liver mitochondria and embryonic mitochondria exhibited greater formate production(PMID:19948730). It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9061 Product name: Recombinant human MTHFD1L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 427-775 aa of BC017477 Sequence: GRMVVASDKSGQPVTADDLGVTGALTVLMKDAIKPNLMQTLEGTPVFVHAGPFANIAHGNSSVLADKIALKLVGEEGFVVTEAGFGADIGMEKFFNIKCRASGLVPNVVVLVATVRALKMHGGGPSVTAGVPLKKEYTEENIQLVADGCCNLQKQIQITQLFGVPVVVALNVFKTDTRAEIDLVCELAKRAGAFDAVPCYHWSVGGKGSVDLARAVREAASKRSRFQFLYDVQVPIVDKIRTIAQAVYGAKDIELSPEAQAKIDRYTQQGFGNLPICMAKTHLSLSHQPDKKGVPRDFILPISDVRASIGAGFIYPLVGTMSTMPGLPTRPCFYDIDLDTETEQVKGLF Predict reactive species Full Name: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like Calculated Molecular Weight: 978 aa, 106 kDa Observed Molecular Weight: 106 kDa GenBank Accession Number: BC017477 Gene Symbol: MTHFD1L Gene ID (NCBI): 25902 RRID: AB_2935394 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6UB35 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.