Iright
BRAND / VENDOR: Proteintech

Proteintech, 68335-1-Ig, TXNDC9 Monoclonal antibody

CATALOG NUMBER: 68335-1-Ig
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TXNDC9 (68335-1-Ig) by Proteintech is a Monoclonal antibody targeting TXNDC9 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 68335-1-Ig targets TXNDC9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: U2OS cells, HEK-293 cells, LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension Background Information TXNDC9, also known as APACD, has a negative effect on protein folding by significantly reducing the activity of chaperone protein TCP1 complex ATPase activity. Including actin or tubulin. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33259 Product name: Recombinant human TXNDC9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-226 aa of BC005968 Sequence: MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD Predict reactive species Full Name: thioredoxin domain containing 9 Calculated Molecular Weight: 226 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC005968 Gene Symbol: TXNDC9 Gene ID (NCBI): 10190 RRID: AB_3085059 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O14530 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924